PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc06g065410.2.1
Common NameLOC101252786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 323aa    MW: 37574.8 Da    PI: 6.437
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc06g065410.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-5371351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eelv +yLk+k+++ k++l +vi+++d+y++ePwd++      ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+
  Solyc06g065410.2.1   7 VPPGFRFHPTEEELVGYYLKRKINSLKIDL-DVITDIDLYRIEPWDIQDrckLGYEEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATGR 96 
                         69****************************.9***************952432234677******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk+vls k++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Solyc06g065410.2.1  97 DKAVLS-KEKIIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 135
                         ******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-605156IPR003441NAC domain
PROSITE profilePS5100558.3967156IPR003441NAC domain
PfamPF023651.5E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MEMDSCVPPG FRFHPTEEEL VGYYLKRKIN SLKIDLDVIT DIDLYRIEPW DIQDRCKLGY  60
EEQNEWYFFS HKDRKYPTGT RTNRATAAGF WKATGRDKAV LSKEKIIGMR KTLVFYKGRA  120
PNGRKSDWIM HEYRLQSSEH APPQEEGWVV CRAFKKPSPN KQPNLDAWQN AYYIRGANTT  180
NYRPNLGITT TPMQPLNNIN VFNQTTNFPQ FTFNPSHNHH DYQNMMINNS STQNFFENQV  240
LVHELPQLDS PTISTSFCTK DNISLGEQSY TVNYNNEDDR GDEEKHSNGI NNNQFNGDWK  300
NFDTLIEPPS HISHLLECFP DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-48215610168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004242232.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9C8W91e-114NAC30_ARATH; NAC domain-containing protein 30
TrEMBLK4C7H00.0K4C7H0_SOLLC; Uncharacterized protein
STRINGSolyc06g065410.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.11e-103vascular related NAC-domain protein 7
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]